DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ube2dnl2

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001075130.1 Gene:Ube2dnl2 / 75097 MGIID:1922347 Length:155 Species:Mus musculus


Alignment Length:163 Identity:57/163 - (34%)
Similarity:88/163 - (53%) Gaps:16/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SELQASLL--LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKE 64
            |.|.|..|  :.::|..:.:.|....|||.|:: ::|.|:..|:||.|:.|:||.|...:.||..
Mouse     4 STLGAMALKRIQKELVAISQDPPAHCSAGPVAE-NMFHWQATIMGPEDSPYQGGVFFLSVHFPNN 67

  Fly    65 YPLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLT 129
            ||.:|||:.|||.::||||.|.|.:|:.||:             ..|.|..|:..:|||:.|:|.
Mouse    68 YPFKPPKVTFITRVYHPNISKNGSICLDILN-------------SMWSPALTISKLLLSICSLLC 119

  Fly   130 DPNDESAANVDAAKEYRENYAEFKRKVTRCVRR 162
            |||.:.....:.||.||::..|:.|......:|
Mouse   120 DPNPDDPLVPEIAKVYRKDLREYNRLAREWTKR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 57/163 (35%)
UQ_con 10..160 CDD:278603 52/149 (35%)
Ube2dnl2NP_001075130.1 COG5078 9..155 CDD:227410 54/158 (34%)
UBCc 9..154 CDD:294101 54/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.