DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and sowaha

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_002935307.1 Gene:sowaha / 733810 XenbaseID:XB-GENE-986451 Length:536 Species:Xenopus tropicalis


Alignment Length:56 Identity:17/56 - (30%)
Similarity:25/56 - (44%) Gaps:10/56 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLS 123
            |..||:.::|     ..|..||   :..:|.:.||.......||  .||:..:|||
 Frog   282 RSSKMQKVSE-----DQKYSDV---VPLDPSEHKWLVTSTNGRW--NHTLYGLLLS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 17/56 (30%)
UQ_con 10..160 CDD:278603 17/56 (30%)
sowahaXP_002935307.1 Ank_2 324..410 CDD:372319 3/4 (75%)
ANK repeat 339..376 CDD:293786
ANK repeat 378..410 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - otm47550
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.