powered by:
Protein Alignment Ubc87F and sowaha
DIOPT Version :9
Sequence 1: | NP_650309.1 |
Gene: | Ubc87F / 41682 |
FlyBaseID: | FBgn0267383 |
Length: | 168 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002935307.1 |
Gene: | sowaha / 733810 |
XenbaseID: | XB-GENE-986451 |
Length: | 536 |
Species: | Xenopus tropicalis |
Alignment Length: | 56 |
Identity: | 17/56 - (30%) |
Similarity: | 25/56 - (44%) |
Gaps: | 10/56 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 RPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLS 123
|..||:.::| ..|..|| :..:|.:.||.......|| .||:..:|||
Frog 282 RSSKMQKVSE-----DQKYSDV---VPLDPSEHKWLVTSTNGRW--NHTLYGLLLS 327
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003121 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm47550 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1582 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X2092 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.030 |
|
Return to query results.
Submit another query.