DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and LOC679539

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_003751372.1 Gene:LOC679539 / 679539 RGDID:1587144 Length:147 Species:Rattus norvegicus


Alignment Length:119 Identity:31/119 - (26%)
Similarity:53/119 - (44%) Gaps:21/119 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEG-FSAGLVSDSD--IFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPK 71
            |..:|.|.|:...:| .|.||..|.|  :.:|..:|||||.|:||...:...:....:||..||.
  Rat    17 LLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPS 81

  Fly    72 MKFITEIWHPNIDKAGDV----CISILHEPGDDKWGYEKAEERWLPVHTVETIL 121
            ::|:|.:....:..:..|    ..::|              .:|...|:::.||
  Rat    82 VRFVTRVNMSGVSSSNGVVDPRATAVL--------------AKWQNSHSIKVIL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 31/119 (26%)
UQ_con 10..160 CDD:278603 31/119 (26%)
LOC679539XP_003751372.1 UBCc 16..142 CDD:214562 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.