DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ube2r2

DIOPT Version :10

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_080551.1 Gene:Ube2r2 / 67615 MGIID:1914865 Length:238 Species:Mus musculus


Alignment Length:175 Identity:88/175 - (50%)
Similarity:111/175 - (63%) Gaps:11/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEY 65
            |:..|.:|:|  :|..||..|||||...||.:||::.|||.|.|||:||||||:||||:.||.:|
Mouse     6 MTSSQKALML--ELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDY 68

  Fly    66 PLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTD 130
            |..||..:|:|::|||||.:.|||||||||.|.||....|...|||.|...|.||||||||:|.:
Mouse    69 PYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNE 133

  Fly   131 PNDESAANVDAAKEYR---------ENYAEFKRKVTRCVRRSQEE 166
            ||..|.|||||:..:|         :.|||..||.....:...|:
Mouse   134 PNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 UBCc_UBE2G1 5..159 CDD:467415 86/162 (53%)
Ube2r2NP_080551.1 UBCc_UBE2R 11..180 CDD:467423 86/170 (51%)
Important for ubiquitin transfer. /evidence=ECO:0000250|UniProtKB:Q712K3 98..113 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.