powered by:
Protein Alignment Ubc87F and ube2v1
DIOPT Version :9
Sequence 1: | NP_650309.1 |
Gene: | Ubc87F / 41682 |
FlyBaseID: | FBgn0267383 |
Length: | 168 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032479.1 |
Gene: | ube2v1 / 641324 |
ZFINID: | ZDB-GENE-051030-102 |
Length: | 147 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 39/72 - (54%) |
Gaps: | 3/72 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 LNRQLSELQRHPVEG-FSAGLVSDSD--IFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPK 71
|..:|.|.|:...:| .|.||..|.| :.:|..:|||||.|:||...:...:.....||..||.
Zfish 17 LLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWRGMIIGPPRTIYENRMYSLRVECGPRYPETPPF 81
Fly 72 MKFITEI 78
::|:|:|
Zfish 82 VRFVTKI 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.