DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2v1

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001032479.1 Gene:ube2v1 / 641324 ZFINID:ZDB-GENE-051030-102 Length:147 Species:Danio rerio


Alignment Length:72 Identity:26/72 - (36%)
Similarity:39/72 - (54%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEG-FSAGLVSDSD--IFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPK 71
            |..:|.|.|:...:| .|.||..|.|  :.:|..:|||||.|:||...:...:.....||..||.
Zfish    17 LLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWRGMIIGPPRTIYENRMYSLRVECGPRYPETPPF 81

  Fly    72 MKFITEI 78
            ::|:|:|
Zfish    82 VRFVTKI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 26/72 (36%)
UQ_con 10..160 CDD:278603 26/72 (36%)
ube2v1NP_001032479.1 UBCc 16..147 CDD:214562 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.