DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ube2j1

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_062532.2 Gene:Ube2j1 / 56228 MGIID:1926245 Length:318 Species:Mus musculus


Alignment Length:143 Identity:38/143 - (26%)
Similarity:72/143 - (50%) Gaps:16/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKF 74
            |.::.:|| :.|.:.:.|..:.| ::|:|...:.||||:.::||.:...::.|.|||::||.:..
Mouse    15 LMKEAAEL-KDPTDHYHAQPLED-NLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIIL 77

  Fly    75 ITEIWHPNIDKAGDVCISIL-HEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAAN 138
            :|......:.|  .:|:||. |.|           |.|.|..::.|.||::|..:....:.:..:
Mouse    78 LTANGRFEVGK--KICLSISGHHP-----------ETWQPSWSIRTALLAIIGFMPTKGEGAIGS 129

  Fly   139 VDAAKEYRENYAE 151
            :|...|.|...|:
Mouse   130 LDYTPEERRALAK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 38/143 (27%)
UQ_con 10..160 CDD:278603 38/143 (27%)
Ube2j1NP_062532.2 UBCc 12..>119 CDD:238117 34/118 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..283
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.