DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2ql1

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_685644.2 Gene:ube2ql1 / 557472 ZFINID:ZDB-GENE-030131-8137 Length:279 Species:Danio rerio


Alignment Length:163 Identity:34/163 - (20%)
Similarity:64/163 - (39%) Gaps:33/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVI--IGPPDTLYEG------GFFKAHLIFPKEYP 66
            |.::|.|::|.. :.|....::|.::|.|.|.:  :.....|::.      .|...::.||..:|
Zfish   118 LMKELQEIRRLG-DSFITVELADDNLFDWNVKLHQVDKDSALWQDMKETNTEFILLNVTFPDNFP 181

  Fly    67 LRPPKMKFITEIWHPNIDK-----AGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVIS 126
            ..||.|:.:|    |.::.     .|.:|:.:|...|            |...:|||.::....:
Zfish   182 FSPPFMRVLT----PRLENGYVLDGGAICMELLTPRG------------WSSAYTVEAVMRQFAA 230

  Fly   127 MLTDPNDESAANVDAAKE---YRENYAEFKRKV 156
            .|.............:|:   .:|..|.||..|
Zfish   231 SLVKGQGRICRKAGKSKKAFSRKEAEATFKSLV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 34/163 (21%)
UQ_con 10..160 CDD:278603 34/163 (21%)
ube2ql1XP_685644.2 UBCc 115..>233 CDD:238117 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.