DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2g2

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001017767.1 Gene:ube2g2 / 550464 ZFINID:ZDB-GENE-050417-288 Length:165 Species:Danio rerio


Alignment Length:161 Identity:86/161 - (53%)
Similarity:110/161 - (68%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASLLLNRQLSE---LQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPL 67
            |...|.|.::|   |..:|.||..||.|::.:.|:||.:|:||.||.:|||.|.|.|..|.:||.
Zfish     2 AGTALKRLMAEYKQLTLNPPEGIVAGPVNEENFFEWEALIMGPEDTCFEGGVFPAILSSPSDYPP 66

  Fly    68 RPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPN 132
            .||||||..:::||||...|.|||||||.||||..|||.:.|||.||.:||.|||||:|||.:||
Zfish    67 SPPKMKFTCDMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPN 131

  Fly   133 DESAANVDAAKEYRENYAEFKRKVTRCVRRS 163
            |||.|||||:|.:||:..:|.|...:.||:|
Zfish   132 DESGANVDASKMWREDREQFNRLAKQIVRKS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 85/159 (53%)
UQ_con 10..160 CDD:278603 82/152 (54%)
ube2g2NP_001017767.1 COG5078 1..163 CDD:227410 86/161 (53%)
UQ_con 8..159 CDD:278603 81/150 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.