DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ube2k

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_058066.2 Gene:Ube2k / 53323 MGIID:1858216 Length:200 Species:Mus musculus


Alignment Length:119 Identity:45/119 - (37%)
Similarity:66/119 - (55%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFITEIWHPNIDK-AGDVCISILHEPGDDKWGYE 105
            |.|||||.||||.::..:..|:.||..|||::|||:||||||.. .|.:|:.||           
Mouse    43 IAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDIL----------- 96

  Fly   106 KAEERWLPVHTVETILLSVISMLT-----DPNDESAANVDAAKEYRENYAEFKR 154
              :::|....|:.|:|||:.::|.     ||.|...||     :|::|...||:
Mouse    97 --KDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAN-----QYKQNPEMFKQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 45/119 (38%)
UQ_con 10..160 CDD:278603 45/119 (38%)
Ube2kNP_058066.2 UBCc 6..149 CDD:238117 45/119 (38%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.