DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and UBE2D4

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_024302563.1 Gene:UBE2D4 / 51619 HGNCID:21647 Length:192 Species:Homo sapiens


Alignment Length:159 Identity:62/159 - (38%)
Similarity:87/159 - (54%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPL 67
            |.||..|   :|::|||.|....|||.|.| |:|.|:..|:||.|:.|:||.|...:.||.:||.
Human    47 EKQACHL---ELTDLQRDPPAQCSAGPVGD-DLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPF 107

  Fly    68 RPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPN 132
            :|||:.|.|:|:||||:..|.:|:.||             ..:|.|..||..:|||:.|:|.|||
Human   108 KPPKVAFTTKIYHPNINSNGSICLDIL-------------RSQWSPALTVSKVLLSICSLLCDPN 159

  Fly   133 DESAANVDAAKEY---RENYAEFKRKVTR 158
            .:.....:.|..|   ||.|....|:.|:
Human   160 PDDPLVPEIAHTYKADREKYNRLAREWTQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 62/159 (39%)
UQ_con 10..160 CDD:278603 58/152 (38%)
UBE2D4XP_024302563.1 UBCc 54..191 CDD:320784 58/149 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.