DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and CG46338

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:144 Identity:27/144 - (18%)
Similarity:57/144 - (39%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYP--LRPPKMKFITEIWHPNIDKAGDVC--- 90
            |.::..:|..|..| ...||....|:..::.|..:|  ...|.:.|..::.||:      ||   
  Fly    45 SYANSLQWFGVFFG-RQGLYAESVFRFTILLPDRFPDDKSLPSIIFQQDVIHPH------VCPYT 102

  Fly    91 --ISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANVDAAKEYRENYAEFK 153
              :.:.|...:.:.|   .:..|..:..::.|....:..:.....:...|.:||:....|..|:.
  Fly   103 HSLDVSHAFPEWRCG---EDHLWQLLKYLQVIFSDPLDSIRGIEVDKLKNSEAAELLMNNKEEYV 164

  Fly   154 RKVTRCVRRSQEEV 167
            .:|...::.|:|.:
  Fly   165 ARVQENIKESKEHI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 25/138 (18%)
UQ_con 10..160 CDD:278603 25/135 (19%)
CG46338NP_524888.1 UBCc 19..169 CDD:294101 25/133 (19%)
COG5078 24..176 CDD:227410 26/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.