DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ubc7

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:161 Identity:88/161 - (54%)
Similarity:107/161 - (66%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASLLLNRQLSE---LQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPL 67
            |...|.|.::|   |...|.||..||.:|:.:.|:||.:|.||..|.:|||.|.|.||||.:|||
  Fly     2 AGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPL 66

  Fly    68 RPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPN 132
            .||||||..:::||||...|.|||||||.||||..|||.:.|||.||.:||.|||||:|||.:||
  Fly    67 SPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPN 131

  Fly   133 DESAANVDAAKEYRENYAEFKRKVTRCVRRS 163
            |||.||||||..:||...||.....|.||::
  Fly   132 DESGANVDAAIMWREQRDEFNAIARRLVRKT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 88/159 (55%)
UQ_con 10..160 CDD:278603 85/152 (56%)
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 88/161 (55%)
UQ_con 8..159 CDD:278603 84/150 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118909at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.