DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and cdc34b

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001002688.1 Gene:cdc34b / 436961 ZFINID:ZDB-GENE-040718-439 Length:239 Species:Danio rerio


Alignment Length:170 Identity:84/170 - (49%)
Similarity:106/170 - (62%) Gaps:11/170 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRP 69
            |.:|:|  ::..||..|||||...||.::|::.|||.|.|||:|.||||:|||.:.||.:||..|
Zfish    13 QKALML--EMKSLQEEPVEGFKITLVDEADLYNWEVAIFGPPNTHYEGGYFKARIKFPVDYPYSP 75

  Fly    70 PKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDE 134
            |..:|:|::|||||.:.|||||||||.|.||....|...|||.|...|.||||||||:|.:||..
Zfish    76 PTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTF 140

  Fly   135 SAANVDAAKEYRE---------NYAEFKRKVTRCVRRSQE 165
            |.|||||:..||:         .|||..||.....:...|
Zfish   141 SPANVDASVMYRKWRDSKGKDREYAEIIRKQVLATKAEAE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 83/166 (50%)
UQ_con 10..160 CDD:278603 81/158 (51%)
cdc34bNP_001002688.1 COG5078 9..172 CDD:227410 83/160 (52%)
UBCc 14..172 CDD:238117 82/159 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101758
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.