DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2r2

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001002600.1 Gene:ube2r2 / 436873 ZFINID:ZDB-GENE-040718-344 Length:250 Species:Danio rerio


Alignment Length:164 Identity:87/164 - (53%)
Similarity:107/164 - (65%) Gaps:11/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEY 65
            |...|.:|:|  :|..||..|||||...||.:||::.|||.|.|||:||||||:||||:.||.:|
Zfish     6 MPSSQKALML--ELKSLQEEPVEGFRITLVEESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDY 68

  Fly    66 PLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTD 130
            |..||..:|:|::|||||.:.|||||||||.|.||....|...|||.|...|.||||||||:|.:
Zfish    69 PYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNE 133

  Fly   131 PNDESAANVDAAKEYR---------ENYAEFKRK 155
            ||..|.|||||:..:|         :.|||..||
Zfish   134 PNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 87/164 (53%)
UQ_con 10..160 CDD:278603 84/155 (54%)
ube2r2NP_001002600.1 COG5078 7..169 CDD:227410 86/163 (53%)
UBCc 11..169 CDD:238117 85/159 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.