DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and CG14739

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:153 Identity:42/153 - (27%)
Similarity:71/153 - (46%) Gaps:22/153 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKF 74
            :||.|:...|..|         |.|:....|.:.||..:.||||.:..::..|::|||..|:::|
  Fly    22 VNRLLASGYRTTV---------DDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPRVRF 77

  Fly    75 ITEIWHPNID-KAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAAN 138
            :|:|.||||: ..|.||:::|.:.....:......|.:||            .:|..||...:.|
  Fly    78 VTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLP------------QLLRYPNPHDSLN 130

  Fly   139 VDAAKEYRENYAEFKRKVTRCVR 161
            ..||...:.:...|:..|..|::
  Fly   131 HRAAAIMKHSEQLFREHVILCMK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 42/153 (27%)
UQ_con 10..160 CDD:278603 41/150 (27%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 42/153 (27%)
UQ_con 17..152 CDD:278603 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.