DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ubc4

DIOPT Version :10

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:152 Identity:53/152 - (34%)
Similarity:78/152 - (51%) Gaps:28/152 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHP--VE-GFSAGLVSDSDIFKWEVV---IIGPPDTLYEGGFFKAHLIFPKEYPLR 68
            :.|:..|:.|..  |: .....||:||    |..:   |.|||||.||||.|...:..|:.||..
  Fly     9 IKREFKEVMRSEEIVQCSIKIELVNDS----WTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69

  Fly    69 PPKMKFITEIWHPNIDK-AGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISML--TD 130
            |||::|||.||||||.. .|.:|:.||             ::.|....|:.|:|||:.::|  .:
  Fly    70 PPKVRFITRIWHPNISSVTGAICLDIL-------------KDNWAAAMTLRTVLLSLQALLAAAE 121

  Fly   131 PNDESAANVDAAKEYRENYAEF 152
            |:|...|.|  |.::::.|..|
  Fly   122 PDDPQDAVV--AYQFKDKYDLF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 UBCc_UBE2G1 5..159 CDD:467415 53/152 (35%)
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 53/152 (35%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.