DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ubc4

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:152 Identity:53/152 - (34%)
Similarity:78/152 - (51%) Gaps:28/152 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHP--VE-GFSAGLVSDSDIFKWEVV---IIGPPDTLYEGGFFKAHLIFPKEYPLR 68
            :.|:..|:.|..  |: .....||:||    |..:   |.|||||.||||.|...:..|:.||..
  Fly     9 IKREFKEVMRSEEIVQCSIKIELVNDS----WTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69

  Fly    69 PPKMKFITEIWHPNIDK-AGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISML--TD 130
            |||::|||.||||||.. .|.:|:.||             ::.|....|:.|:|||:.::|  .:
  Fly    70 PPKVRFITRIWHPNISSVTGAICLDIL-------------KDNWAAAMTLRTVLLSLQALLAAAE 121

  Fly   131 PNDESAANVDAAKEYRENYAEF 152
            |:|...|.|  |.::::.|..|
  Fly   122 PDDPQDAVV--AYQFKDKYDLF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 53/152 (35%)
UQ_con 10..160 CDD:278603 53/152 (35%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 53/152 (35%)
UQ_con 8..149 CDD:278603 53/152 (35%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.