DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and UbcE2M

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster


Alignment Length:156 Identity:43/156 - (27%)
Similarity:75/156 - (48%) Gaps:16/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPP 70
            |.|.:.:.::||  :.....:......:|:..:: :||.|.:..|..|.|..:......||..||
  Fly    27 AQLRIQKDINEL--NLPNTCATDFPDPNDLLNFK-LIISPDEGFYRDGRFVFNFRVGSNYPHEPP 88

  Fly    71 KMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDES 135
            |:|..|:::|||||..|:||::||.|.             |.||..:.:|:..:..:..:||.|.
  Fly    89 KVKCATQVYHPNIDLDGNVCLNILRED-------------WNPVLNINSIVYGLQFLFLEPNPED 140

  Fly   136 AANVDAAKEYRENYAEFKRKVTRCVR 161
            ..|.:||...:.|..:|:..|.:.:|
  Fly   141 PLNKEAADVLQTNRRQFENNVKKAMR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 43/156 (28%)
UQ_con 10..160 CDD:278603 40/149 (27%)
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 40/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.