DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Uev1A

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:123 Identity:35/123 - (28%)
Similarity:61/123 - (49%) Gaps:13/123 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEG-FSAGLVSDSD--IFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPK 71
            |..:|.:.|:...:| .|.||.:|.|  :..|..:|||||.|.:|...:...:...:.||..||.
  Fly    17 LLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPT 81

  Fly    72 MKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLT 129
            ::|||::   ||:     ||:..:...|.:.....|  ||...:.::|:|..:..::|
  Fly    82 LRFITKV---NIN-----CINQNNGVVDHRSVQMLA--RWSREYNIKTMLQEIRRIMT 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 35/123 (28%)
UQ_con 10..160 CDD:278603 35/123 (28%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.