DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and CG16894

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:178 Identity:35/178 - (19%)
Similarity:70/178 - (39%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYP--LRPPK 71
            |:..:|..:  :.:..::.||       .|..||. ....:|.|..|:..::.|:.:|  :..|.
  Fly    26 LVKEELKNI--YAIPSYACGL-------HWFGVIF-VHSGIYAGSVFRFSILLPENFPADISLPT 80

  Fly    72 MKFITEIWHPNI---DKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPND 133
            :.|.||:.||:|   :|..|:. ..|:|       :.|.|      |.:..:|..:.::..||..
  Fly    81 VVFSTEVLHPHICPQNKTLDLA-HFLNE-------WRKDE------HHIWHVLRYIQAIFADPEG 131

  Fly   134 ---------------ESAANVDAAKEYRENYAEFKRKVTRCVRRSQEE 166
                           :...|::|.....::..|:       ::|.||:
  Fly   132 SICTGQSSSGDLVIMDEVRNMNALNMLAKSRPEY-------IKRVQEQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 32/173 (18%)
UQ_con 10..160 CDD:278603 31/169 (18%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 35/178 (20%)
UBCc 23..173 CDD:294101 35/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.