DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and CG3473

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:157 Identity:54/157 - (34%)
Similarity:90/157 - (57%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLNRQLSELQR---HPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPP 70
            |..|.:.|.||   .||.|.|| ...:.:...:.|::.||.|:.:|||.||..|..|::||::.|
  Fly     4 LTPRIIKETQRLLEDPVPGISA-TPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAP 67

  Fly    71 KMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPN-DE 134
            |::|:|:|:|||||:.|.:|:.||             :::|.|...:.|:|||:.::|:.|| |:
  Fly    68 KVRFLTKIFHPNIDRVGRICLDIL-------------KDKWSPALQIRTVLLSIQALLSAPNPDD 119

  Fly   135 SAANVDAAKEYRENYAEFKRKVTRCVR 161
            ..|| |.|:.::.|    :|:..:..|
  Fly   120 PLAN-DVAELWKVN----ERRAIQLAR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 54/157 (34%)
UQ_con 10..160 CDD:278603 52/153 (34%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 54/157 (34%)
COG5078 7..149 CDD:227410 53/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.