DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2g1a

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_956157.1 Gene:ube2g1a / 334133 ZFINID:ZDB-GENE-030131-6065 Length:170 Species:Danio rerio


Alignment Length:166 Identity:128/166 - (77%)
Similarity:152/166 - (91%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEY 65
            |:|.|::|||.|||:||.::|||||||||:.|:|:::|||:||||||||||||.|||||.|||:|
Zfish     1 MTEPQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDY 65

  Fly    66 PLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTD 130
            |||||||||||||||||:||.||||||||||||:||:||||.||||||:||||||::||||||.|
Zfish    66 PLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLAD 130

  Fly   131 PNDESAANVDAAKEYREN-YAEFKRKVTRCVRRSQE 165
            ||.:|.||||||||:||: :.||||||.||||:|||
Zfish   131 PNGDSPANVDAAKEWREDRHGEFKRKVARCVRKSQE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 125/162 (77%)
UQ_con 10..160 CDD:278603 117/150 (78%)
ube2g1aNP_956157.1 UQ_con 10..161 CDD:395127 117/150 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I2676
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - mtm6562
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.