DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and CG8188

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:144 Identity:48/144 - (33%)
Similarity:80/144 - (55%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFIT 76
            |:|.|::..|.||... |:::||:...:.:|.||..|.|..|.|:..|...|::||.|||..|:|
  Fly    21 RELQEMETTPPEGIKV-LINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPLTPPKAYFLT 84

  Fly    77 EIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANVDA 141
            :|:|||:...|::|::.|             ::.|.|...::.|||::..:|..||.|||.|.:|
  Fly    85 KIFHPNVAANGEICVNTL-------------KKDWKPDLGIKHILLTIKCLLIVPNPESALNEEA 136

  Fly   142 AKEYRENYAEFKRK 155
            .|...|.|.::.::
  Fly   137 GKMLLERYDDYSQR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 48/144 (33%)
UQ_con 10..160 CDD:278603 48/144 (33%)
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 48/144 (33%)
UBCc 16..155 CDD:238117 48/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.