DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ubc-26

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001348718.1 Gene:ubc-26 / 259424 WormBaseID:WBGene00022450 Length:238 Species:Caenorhabditis elegans


Alignment Length:145 Identity:41/145 - (28%)
Similarity:70/145 - (48%) Gaps:20/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKF 74
            |.:....|.:.||. |......:::|.:|..:|||.|.|.||||.:...|:|||::|.:||.:..
 Worm    13 LKKDYQRLLKEPVP-FMKAAPLETNILEWRYIIIGAPKTPYEGGIYMGKLLFPKDFPFKPPAILM 76

  Fly    75 ITEIWHPN--IDKAGDVCISIL-HEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESA 136
            :|    ||  ......:|:||. :.|           :.|.|..||.||:..::|.:.| |..:.
 Worm    77 LT----PNGRFQTNTRLCLSISDYHP-----------DTWNPAWTVSTIITGLMSFMND-NQPTL 125

  Fly   137 ANVDAAKEYRENYAE 151
            .::..::..|:..|:
 Worm   126 GSLVTSESERKLLAK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 41/145 (28%)
UQ_con 10..160 CDD:278603 41/145 (28%)
ubc-26NP_001348718.1 UBCc 11..>120 CDD:238117 37/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.