DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ubc1

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_596239.1 Gene:ubc1 / 2540277 PomBaseID:SPBC2D10.20 Length:217 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:47/144 - (32%)
Similarity:81/144 - (56%) Gaps:15/144 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFIT 76
            ::|:::|:....|.....::| ||...:.:..||..|.||||:|...:..|.:||.|||||.|.|
pombe    11 KELADVQQDKQAGIQVWTIND-DISHLKGMFRGPEGTPYEGGYFVVDIEIPIDYPFRPPKMNFDT 74

  Fly    77 EIWHPNI-DKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANVD 140
            :|:|||: .:.|.:|:.||             :::|.||:|:::.|:|:.|:|..|...:..:..
pombe    75 KIYHPNVSSQTGAICLDIL-------------KDQWSPVYTMKSALISLQSLLCTPEPSNPQDAQ 126

  Fly   141 AAKEYRENYAEFKR 154
            .|:.|.:||.:|.|
pombe   127 VAQVYLQNYQQFVR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 47/144 (33%)
UQ_con 10..160 CDD:278603 47/144 (33%)
ubc1NP_596239.1 COG5078 1..150 CDD:227410 47/144 (33%)
UBCc 6..146 CDD:238117 47/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.