DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ubc15

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_596465.1 Gene:ubc15 / 2539995 PomBaseID:SPBC1105.09 Length:167 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:111/159 - (69%)
Similarity:131/159 - (82%) Gaps:0/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMK 73
            ||.:||.|:|::|.:|||.|||.|..||:|||:||||.|||||||||.|.|.||::|||.|||||
pombe     9 LLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLSFPQDYPLMPPKMK 73

  Fly    74 FITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAAN 138
            |.|||||||:...|:|||||||.|||||:|||.|.|||||||:.||||:||||||:.|||||.||
pombe    74 FTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISMLSSPNDESPAN 138

  Fly   139 VDAAKEYRENYAEFKRKVTRCVRRSQEEV 167
            :|||||:|||..|||::|.|.||||.|.:
pombe   139 IDAAKEFRENPQEFKKRVRRLVRRSIEMI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 108/153 (71%)
UQ_con 10..160 CDD:278603 105/149 (70%)
ubc15NP_596465.1 COG5078 1..152 CDD:227410 101/142 (71%)
UQ_con 10..152 CDD:278603 100/141 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 235 1.000 Domainoid score I480
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 244 1.000 Inparanoid score I807
OMA 1 1.010 - - QHG54250
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - otm47005
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.