DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ubc-7

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_499133.1 Gene:ubc-7 / 176363 WormBaseID:WBGene00006704 Length:164 Species:Caenorhabditis elegans


Alignment Length:162 Identity:129/162 - (79%)
Similarity:149/162 - (91%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRP 69
            |:||||.:||::::|.||:|||||||.|:||:||||::|||||||||||||||.|.||::||.:|
 Worm     3 QSSLLLKKQLADMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKP 67

  Fly    70 PKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDE 134
            ||||||:|||||||||.|:|||||||:|||||||||:.|||||||||||||||||||||||||.|
 Worm    68 PKMKFISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLSVISMLTDPNFE 132

  Fly   135 SAANVDAAKEYRENYAEFKRKVTRCVRRSQEE 166
            |.|||||||..||||||||:||.:||||||||
 Worm   133 SPANVDAAKMQRENYAEFKKKVAQCVRRSQEE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 124/157 (79%)
UQ_con 10..160 CDD:278603 117/149 (79%)
ubc-7NP_499133.1 COG5078 8..161 CDD:227410 120/152 (79%)
UQ_con 8..158 CDD:278603 117/149 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157507
Domainoid 1 1.000 259 1.000 Domainoid score I1073
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81417
Inparanoid 1 1.050 279 1.000 Inparanoid score I1766
Isobase 1 0.950 - 0 Normalized mean entropy S254
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - otm14326
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1582
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1716.790

Return to query results.
Submit another query.