DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ubc-16

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_493587.1 Gene:ubc-16 / 173354 WormBaseID:WBGene00006711 Length:152 Species:Caenorhabditis elegans


Alignment Length:139 Identity:42/139 - (30%)
Similarity:70/139 - (50%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASLLLNRQLSELQRHPVEGFSAGLVSDS-DIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRP 69
            |:..|.::|::|:....||......|.| |:.:|::.::|...|||.|..|.....|..:||...
 Worm     5 ATRRLMKELAQLKSEAPEGLLVDNTSTSNDLKQWKIGVVGAEGTLYAGEVFMLQFTFGPQYPFNS 69

  Fly    70 PKMKFITEI--WHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPN 132
            |::.|:.|.  .||:|...|.:|:|||   .||          |.|..:|:::.||::|||:...
 Worm    70 PEVMFVGETIPAHPHIYSNGHICLSIL---SDD----------WTPALSVQSVCLSILSMLSSSK 121

  Fly   133 DESAANVDA 141
            ::.....||
 Worm   122 EKKHPIDDA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 42/139 (30%)
UQ_con 10..160 CDD:278603 41/135 (30%)
ubc-16NP_493587.1 UQ_con 8..>110 CDD:365926 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.