DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ubc-14

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001370084.1 Gene:ubc-14 / 173228 WormBaseID:WBGene00006709 Length:170 Species:Caenorhabditis elegans


Alignment Length:154 Identity:78/154 - (50%)
Similarity:103/154 - (66%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKF 74
            |..:..||...|.||..|..:.:.:.|:||.:|.||.:|.:..|.|.|.:.||::|||.||||:|
 Worm     9 LMTEYKELTTRPPEGIIAAPIDEDNFFEWECLITGPEETCFANGVFPARITFPQDYPLSPPKMRF 73

  Fly    75 ITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANV 139
            ...|:||||...|.|||||||.||||..|||.:.|||.||.::|.|||||:|||.:|||||.|||
 Worm    74 TCGIFHPNIYADGRVCISILHAPGDDPTGYELSNERWSPVQSIEKILLSVVSMLAEPNDESPANV 138

  Fly   140 DAAKEYRENYAEFKRKVTRCVRRS 163
            .|||.:||:.|:|::.....||::
 Worm   139 SAAKMWREDRAQFEKIADSLVRKT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 78/152 (51%)
UQ_con 10..160 CDD:278603 76/149 (51%)
ubc-14NP_001370084.1 UQ_con 8..159 CDD:395127 76/149 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.