DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and AgaP_AGAP005916

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_315947.2 Gene:AgaP_AGAP005916 / 1276584 VectorBaseID:AGAP005916 Length:183 Species:Anopheles gambiae


Alignment Length:156 Identity:43/156 - (27%)
Similarity:77/156 - (49%) Gaps:16/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPP 70
            |.|.:.:.::||  :..:..:.......|:..::::|. |.:..|:.|.|..:......||..||
Mosquito    30 AQLRITKDINEL--NLPKTCATEFPDPDDLLNFKLIIC-PDEGFYKSGRFVFNFKVGPNYPHEPP 91

  Fly    71 KMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDES 135
            |:|..|:::|||||..|:||::||.|.             |.||.|:.:|:..:..:..:||.|.
Mosquito    92 KVKCETQVYHPNIDLEGNVCLNILRED-------------WKPVLTINSIVYGLQYLFLEPNPED 143

  Fly   136 AANVDAAKEYRENYAEFKRKVTRCVR 161
            ..|.:||:..:.|...|:..|.:.:|
Mosquito   144 PLNREAAEVLQTNRRLFEHNVFKAMR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 43/156 (28%)
UQ_con 10..160 CDD:278603 40/149 (27%)
AgaP_AGAP005916XP_315947.2 COG5078 29..170 CDD:227410 43/156 (28%)
UQ_con 33..164 CDD:278603 39/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.