DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2ia

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_571908.1 Gene:ube2ia / 114445 ZFINID:ZDB-GENE-010607-1 Length:157 Species:Danio rerio


Alignment Length:160 Identity:54/160 - (33%)
Similarity:81/160 - (50%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQASLLLNRQLSELQRHPVEGFSAGLVSDSD----IFKWEVVIIGPPDTLYEGGFFKAHLIF 61
            ||.:..|.|...:.:..:.||. ||.|....:.|    :..||..|.|...|.:|||.||..::|
Zfish     1 MSGIALSRLAQERKAWRKDHPF-GFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLF 64

  Fly    62 PKEYPLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVIS 126
            ..:||..|||.||...::|||:..:|.||:|||.|..|           |.|..|::.|||.:..
Zfish    65 KDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD-----------WRPAITIKQILLGIQE 118

  Fly   127 MLTDPNDESAANVDAAKEYRENYAEFKRKV 156
            :|.:||.:..|..:|...|.:|..|::::|
Zfish   119 LLNEPNIQDPAQAEAYTIYCQNRVEYEKRV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 54/160 (34%)
UQ_con 10..160 CDD:278603 50/151 (33%)
ube2iaNP_571908.1 UQ_con 8..152 CDD:395127 51/153 (33%)
Interaction with SUMO1. /evidence=ECO:0000250 13..18 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.