DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2u

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_004913986.1 Gene:ube2u / 101733423 XenbaseID:XB-GENE-980226 Length:317 Species:Xenopus tropicalis


Alignment Length:162 Identity:49/162 - (30%)
Similarity:92/162 - (56%) Gaps:13/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEY 65
            |.:.:..|||.|:..:|:.:.:.|.||..:|| ::.:|...:.|..|:::||...:..:.:.::|
 Frog     1 MMQSRICLLLKREYQDLKENQLFGISAAPISD-NLVEWIAKVQGLKDSIWEGAVLQLAMRYTEKY 64

  Fly    66 PLRPPKMKFITEIWHPNIDK-AGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLT 129
            ...||.:||.|..:|||:|. :|.:|:..|..|           |:|.|..|:..:||::.:||:
 Frog    65 NYEPPSIKFNTIPFHPNVDPVSGKLCLPFLDIP-----------EQWNPCITMSNMLLTIQAMLS 118

  Fly   130 DPNDESAANVDAAKEYRENYAEFKRKVTRCVR 161
            :|..|:|.|::||:..:.|.:.::..|:.|||
 Frog   119 NPVSENAVNLEAAQMLKINPSMYRAVVSNCVR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 49/162 (30%)
UQ_con 10..160 CDD:278603 43/150 (29%)
ube2uXP_004913986.1 COG5078 1..150 CDD:227410 47/160 (29%)
UQ_con 10..149 CDD:278603 43/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.