DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-C and AMD1

DIOPT Version :9

Sequence 1:NP_650308.3 Gene:Adgf-C / 41680 FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_013677.1 Gene:AMD1 / 854973 SGDID:S000004498 Length:810 Species:Saccharomyces cerevisiae


Alignment Length:410 Identity:88/410 - (21%)
Similarity:136/410 - (33%) Gaps:144/410 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 HVHNTASVSSKWVVDDLSYMPGLLRCTTATGQSILSFRRTPKEHKCQSQYV------LVSDERRN 166
            |||::|.::.|                     .:|.|.:....|....:.:      |..||...
Yeast   362 HVHHSACMNQK---------------------HLLRFIKHKLRHSKDEKVIFRDGKLLTLDEVFR 405

  Fly   167 SLDRQVYDRNFERL--------------INL-YTPVPELEYPTITRVWDRFQGMFDGLSDAL--I 214
            ||....||.:.:.|              .|| |.|:.|          .|.:.:|...::.:  .
Yeast   406 SLHLTGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGE----------SRLREIFLKTNNYIKGT 460

  Fly   215 YLPAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHELYALNQKFMKLHPDFL 279
            ||.....   |::.:|.|......|.|.|   :|   ||:.             .::.||....:
Yeast   461 YLADITK---QVIFDLENSKYQNCEYRIS---VY---GRSL-------------DEWDKLASWVI 503

  Fly   280 GFKVI-------MAVYRGYELDHLKDIVEVFK---------------------KLHQALPHFLVG 316
            ..|||       :.:.|.|::.....||:.|:                     |||..|.. ::|
Yeast   504 DNKVISHNVRWLVQIPRLYDIYKKTGIVQSFQDICKNLFQPLFEVTKNPQSHPKLHVFLQR-VIG 567

  Fly   317 FDLVGQEDK---------GKP-----------------LYSLLPVLRDLPP-----TARLFLHGG 350
            ||.|..|.|         .||                 |||.:..|.....     |..|..|.|
Yeast   568 FDSVDDESKVDRRFHRKYPKPSLWEAPQNPPYSYYLYYLYSNVASLNQWRAKRGFNTLVLRPHCG 632

  Fly   351 ETNWFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVWDLRN 415
            |     |....:|:.|.|: ...|.||..|.|.|.:.......::.:.:||:||..|.|.:|  .
Yeast   633 E-----AGDPEHLVSAYLL-AHGISHGILLRKVPFVQYLYYLDQVGIAMSPLSNNALFLTYD--K 689

  Fly   416 HPGSQFFALDVPVVICNDDP 435
            :|..::|...:.|.:..|||
Yeast   690 NPFPRYFKRGLNVSLSTDDP 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627
adm_rel 25..501 CDD:273620 88/410 (21%)
ADGF 78..493 CDD:238646 88/410 (21%)
AMD1NP_013677.1 AMPD 299..794 CDD:238644 88/410 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.