DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-C and AT4G04880

DIOPT Version :10

Sequence 1:NP_650308.3 Gene:Adgf-C / 41680 FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001328400.1 Gene:AT4G04880 / 825826 AraportID:AT4G04880 Length:384 Species:Arabidopsis thaliana


Alignment Length:156 Identity:36/156 - (23%)
Similarity:63/156 - (40%) Gaps:42/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 PMAEDVNGDVYCMDCKLLLDSNAE--FRQAKLFDLKDKKQEDELEIRAAAANLNYIRLDGTIGCM 292
            |:...:|     ||...|.::.|.  ..|...::| |..|...:.|.|.||::      |..|  
plant   373 PVGATIN-----MDGTALYEAVAAIFIAQVNNYEL-DFGQIITISITATAASI------GAAG-- 423

  Fly   293 VNGAGLAMATMDIIKLHGGEPANFLDVGGGATVEQVTEAFKIITADKDKVSAILVNIFGGIMRCD 357
            :..|||  .||.|:....|.|.:  |:.....|:...:.|:           .::|:.|     |
plant   424 IPQAGL--VTMVIVLTSVGLPTD--DITLIIAVDWALDRFR-----------TMINVLG-----D 468

  Fly   358 VIAQGII------QAARELDLKIPIV 377
            .:|.||:      ..|::.|.::|::
plant   469 ALAAGIMAHICRKDFAKQNDEQVPLI 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 4..98 CDD:462481
ADGF 78..493 CDD:238646 36/156 (23%)
AT4G04880NP_001328400.1 ADA_AMPD 7..373 CDD:238250 36/156 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.