DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-C and Ada

DIOPT Version :9

Sequence 1:NP_650308.3 Gene:Adgf-C / 41680 FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001258981.1 Gene:Ada / 11486 MGIID:87916 Length:352 Species:Mus musculus


Alignment Length:331 Identity:71/331 - (21%)
Similarity:122/331 - (36%) Gaps:60/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 ERLINLYTPVPELEYPTITRVWDRFQGMFDGLSDALIYLPAFRAYHWQMLEELYNDNVMYTEIRT 242
            |.|.|:......|..|.....:|.:..:..|..:|:      :...::.:|....:.|:|.|:|.
Mouse    44 EELRNIIGMDKPLSLPGFLAKFDYYMPVIAGCREAI------KRIAYEFVEMKAKEGVVYVEVRY 102

  Fly   243 SFKTLYDASGRTFPRERTIHELY------ALNQKFMKLHPDFLGFKV--IMAVYRGYELDHLKDI 299
            |...|.::.....|..:|..::.      .:||...:....| |.||  |:...| ::.....::
Mouse   103 SPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAF-GIKVRSILCCMR-HQPSWSLEV 165

  Fly   300 VEVFKKLHQALPHFLVGFDLVGQED-KGKPLYSLLP---------VLRDLPPTARLFLHGGETNW 354
            :|:.||.:|..   :|..||.|.|. :|.   ||.|         |...:..|    :|.||.  
Mouse   166 LELCKKYNQKT---VVAMDLAGDETIEGS---SLFPGHVEAYEGAVKNGIHRT----VHAGEV-- 218

  Fly   355 FGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISN--------QVLHLVW 411
              .|.::......::.|.|:||||...:...|.|.:....:..|:.|.|:        :..|.|.
Mouse   219 --GSPEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAVV 281

  Fly   412 DLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRYST 476
            ..:|...:.....|.|::       |.:.....|......|......     .|.|..|:.:.|.
Mouse   282 RFKNDKANYSLNTDDPLI-------FKSTLDTDYQMTKKDMGFTEEE-----FKRLNINAAKSSF 334

  Fly   477 LTEEEQ 482
            |.|||:
Mouse   335 LPEEEK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627
adm_rel 25..501 CDD:273620 71/331 (21%)
ADGF 78..493 CDD:238646 71/331 (21%)
AdaNP_001258981.1 ADA 8..336 CDD:238645 67/325 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.