DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-D and AMPD3

DIOPT Version :9

Sequence 1:NP_524345.2 Gene:Adgf-D / 41679 FlyBaseID:FBgn0038172 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_000471.1 Gene:AMPD3 / 272 HGNCID:470 Length:776 Species:Homo sapiens


Alignment Length:507 Identity:99/507 - (19%)
Similarity:168/507 - (33%) Gaps:188/507 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FQGRQYVRQSEVFRMIQKIPKGAFLHGHNTGMVTSRWIIQNLTTTNNLYTCRNVDGLLVF---TY 146
            |...:.:.:...|:.::..|...|.:            ::.:.|..:...|.|...||.|   ||
Human   294 FSLHEMLNEMSEFKELKSNPHRDFYN------------VRKVDTHIHAAACMNQKHLLRFIKHTY 346

  Fly   147 DQSGCHSEVQNVCTERINAEDRGK---------------YERQLEKHINMHGPRPEALLPNRKKI 196
            ...          .:|..||.||:               |:..::. :::|..|         :.
Human   347 QTE----------PDRTVAEKRGRKITLRQVFDGLHMDPYDLTVDS-LDVHAGR---------QT 391

  Fly   197 WERFENIFTTVDRLYKYRPTYCA----------------YHKRMLEELC----EDNIIYAEIRAS 241
            :.||:...:      ||.|...:                |..||::|:.    |....|:|.|.|
Human   392 FHRFDKFNS------KYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEESKYQYSEPRLS 450

  Fly   242 L---SP--------------LYDDNNRTLSTLEVANELERIVEEFKAKHHDFIGVKVI--YAKRN 287
            :   ||              :|..|.|.:.      ::.||.:.|::|       |::  :.|  
Human   451 IYGRSPEEWPNLAYWFIQHKVYSPNMRWII------QVPRIYDIFRSK-------KLLPNFGK-- 500

  Fly   288 RASEEEMLRRI-------TTFKQLH---HAKPNFVIGFDLIGQED-----------------TGE 325
                  ||..|       |...|.|   |....:|.|||.:..|.                 |.|
Human   501 ------MLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPNPDVWTSE 559

  Fly   326 ---PLNRY----------INQLSDLPSTANYFF--HAGETNWNGRTDWNMMDAILLNTKRIGHAF 375
               |.:.|          :|.|......:.:.|  |.||..    :..:::.| .|....|.|..
Human   560 QNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAG----SITHLVSA-FLTADNISHGL 619

  Fly   376 ALPKHPQLWSTIKKRNIAIEVNPISNQVLGFVWDLRNHPASFLIAENFPIVISSDDPGVWGAKGL 440
            .|.|.|.|........|.|.::|:||..| |: :...:|....:.:...:.:|:|||        
Human   620 LLKKSPVLQYLYYLAQIPIAMSPLSNNSL-FL-EYSKNPLREFLHKGLHVSLSTDDP-------- 674

  Fly   441 SYDFYYAFMALAP-----------ADADLRFLKQLALNSIKYAVLTSDERRK 481
             ..|:|...||..           :..|   |.::|.||:..:.|:..|::|
Human   675 -MQFHYTKEALMEEYAIAAQVWKLSTCD---LCEIARNSVLQSGLSHQEKQK 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-DNP_524345.2 A_deaminase_N 4..100 CDD:285627 2/14 (14%)
adm_rel 27..498 CDD:273620 99/507 (20%)
ADGF 80..490 CDD:238646 99/507 (20%)
AMPD3NP_000471.1 AMP_deaminase 155..762 CDD:273618 99/507 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.