DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-D and Ampd3

DIOPT Version :9

Sequence 1:NP_524345.2 Gene:Adgf-D / 41679 FlyBaseID:FBgn0038172 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001359370.1 Gene:Ampd3 / 11717 MGIID:1096344 Length:775 Species:Mus musculus


Alignment Length:573 Identity:110/573 - (19%)
Similarity:189/573 - (32%) Gaps:221/573 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LPYETLREQIMEAERVASLGGNIWLSSDEEKANSILMNAKRAEIAEGLKTPEK-YA-PAMHFFQG 87
            |||..|...|::...:.:|                        |.:|   |.| |. ..::|.:.
Mouse   254 LPYPDLETYIVDMSHILAL------------------------ITDG---PTKTYCHRRLNFLES 291

  Fly    88 R----QYVRQSEVFRMIQKIPKGAFLHGHNTGMVTSRWIIQNLTTTNNLYTCRNVDGLLVF---T 145
            :    :.:.:...|:.::..|...|.:            ::.:.|..:...|.|...||.|   |
Mouse   292 KFSLHEMLNEMSEFKELKSNPHRDFYN------------VRKVDTHIHAAACMNQKHLLRFIKHT 344

  Fly   146 YDQSGCHSEVQNVCTERINAEDRGK---------------YERQLEKHINMHGPRPEALLPNRKK 195
            |...          .:|..||..|:               |:..::. :::|..|         :
Mouse   345 YQTE----------PDRTVAEKLGRKITLRQVFDSLHMDPYDLTVDS-LDVHAGR---------Q 389

  Fly   196 IWERFENIFTTVDRLYKYRPTYCA----------------YHKRMLEELC---EDN-IIYAEIRA 240
            .:.||:...:      ||.|...:                |..||::|:.   ||: ..|:|.|.
Mouse   390 TFHRFDKFNS------KYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRL 448

  Fly   241 SL---SP--------------LYDDNNRTLSTLEVANELERIVEEFKAKHHDFIGVKVI--YAKR 286
            |:   ||              :|..|.|.:.      ::.||.:.|::|       |::  :.| 
Mouse   449 SIYGRSPKEWSSLARWFIQHKVYSPNMRWII------QVPRIYDIFRSK-------KLLPNFGK- 499

  Fly   287 NRASEEEMLRRI-------TTFKQLH---HAKPNFVIGFDLIGQED-----------------TG 324
                   ||..|       |...|.|   |....:|.|||.:..|.                 |.
Mouse   500 -------MLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTS 557

  Fly   325 E---PLNRY----------INQLSDLPSTANYFF--HAGETNWNGRTDWNMMDAILLNTKRIGHA 374
            |   |.:.|          :|.|......:.:.|  |.||..    :..:::.| .|....|.|.
Mouse   558 EQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAG----SITHLVSA-FLTADNISHG 617

  Fly   375 FALPKHPQLWSTIKKRNIAIEVNPISNQVLGFVWDLRNHPASFLIAENFPIVISSDDPGVWGAKG 439
            ..|.|.|.|........|.|.::|:||..| |: :...:|....:.:...:.:|:|||       
Mouse   618 LLLKKSPVLQYLYYLAQIPIAMSPLSNNSL-FL-EYSKNPLREFLHKGLHVSLSTDDP------- 673

  Fly   440 LSYDFYYAFMALAP-----------ADADLRFLKQLALNSIKYAVLTSDERRK 481
              ..|:|...||..           :..|   |.::|.||:..:.|:..|::|
Mouse   674 --MQFHYTKEALMEEYAIAAQVWKLSTCD---LCEIARNSVLQSGLSHQEKQK 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-DNP_524345.2 A_deaminase_N 4..100 CDD:285627 13/80 (16%)
adm_rel 27..498 CDD:273620 108/571 (19%)
ADGF 80..490 CDD:238646 99/516 (19%)
Ampd3NP_001359370.1 AMP_deaminase 155..761 CDD:273618 110/573 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.