DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-D and Ada

DIOPT Version :9

Sequence 1:NP_524345.2 Gene:Adgf-D / 41679 FlyBaseID:FBgn0038172 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001258981.1 Gene:Ada / 11486 MGIID:87916 Length:352 Species:Mus musculus


Alignment Length:379 Identity:80/379 - (21%)
Similarity:146/379 - (38%) Gaps:98/379 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QLEKHINMHGP-RPEALLPNRKK--------IWERFENIFTTVDR-------LYK---YRPTYCA 219
            ::|.|:::.|. :||.:|...||        ..|...||. .:|:       |.|   |.|....
Mouse    11 KVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNII-GMDKPLSLPGFLAKFDYYMPVIAG 74

  Fly   220 YH---KRMLEELCE----DNIIYAEIRASLSPLYDDN------NRTLSTLEVANELERIVEEFKA 271
            ..   ||:..|..|    :.::|.|:|.|...|.:..      |:|...: ..:::..:|.:...
Mouse    75 CREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPMPWNQTEGDV-TPDDVVDLVNQGLQ 138

  Fly   272 KHHDFIGVKV---IYAKRNRAS-EEEMLRRITTFKQLHHAKPNFVIGFDLIGQEDTGEPLNRYIN 332
            :.....|:||   :...|::.| ..|:|.....:.|      ..|:..||.|.|.        |.
Mouse   139 EGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQ------KTVVAMDLAGDET--------IE 189

  Fly   333 QLSDLPSTANYF-----------FHAGETNWNGRTDWNMMDAI-LLNTKRIGHAFALPKHPQLWS 385
            ..|..|.....:           .||||..    :...:.:|: :|.|:|:||.:...:...|::
Mouse   190 GSSLFPGHVEAYEGAVKNGIHRTVHAGEVG----SPEVVREAVDILKTERVGHGYHTIEDEALYN 250

  Fly   386 TIKKRNIAIEVNPISNQVLGFVWD---------LRNHPASFLIAENFPIVISSDDPGVWGAKGLS 441
            .:.|.|:..||.|.|:.:.| .||         .:|..|::.:..:.|::..|.         |.
Mouse   251 RLLKENMHFEVCPWSSYLTG-AWDPKTTHAVVRFKNDKANYSLNTDDPLIFKST---------LD 305

  Fly   442 YDFYYAFMALAPADADLRF----LKQLALNSIKYAVLTSDERRKINRVFQRKWQ 491
            .|:..       ...|:.|    .|:|.:|:.|.:.|..:|::::.....|::|
Mouse   306 TDYQM-------TKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLERLYREYQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-DNP_524345.2 A_deaminase_N 4..100 CDD:285627
adm_rel 27..498 CDD:273620 80/379 (21%)
ADGF 80..490 CDD:238646 79/376 (21%)
AdaNP_001258981.1 ADA 8..336 CDD:238645 76/361 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.