DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-D and ADA

DIOPT Version :9

Sequence 1:NP_524345.2 Gene:Adgf-D / 41679 FlyBaseID:FBgn0038172 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_000013.2 Gene:ADA / 100 HGNCID:186 Length:363 Species:Homo sapiens


Alignment Length:368 Identity:77/368 - (20%)
Similarity:142/368 - (38%) Gaps:94/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QLEKHINMHGP-RPEALL--PNRKKI------WERFENI------FTTVDRLYK---YRPTYCAY 220
            ::|.|:::.|. :||.:|  ..|:.|      .|...|:      .|..|.|.|   |.|.....
Human    11 KVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGC 75

  Fly   221 H---KRMLEELCE----DNIIYAEIRASLSPLYDDNNRTLSTLEVANEL--ERIV----EEFKAK 272
            .   ||:..|..|    :.::|.|:|.|...|.:.....:...:...:|  :.:|    :..:..
Human    76 REAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEG 140

  Fly   273 HHDFIGVK---VIYAKRNRAS-EEEMLRRITTFKQLHHAKPNFVIGFDLIGQEDTGEPLNRYINQ 333
            ..|| |||   ::...|::.: ..:::.....::|      ..|:..||.|.|.        |..
Human   141 ERDF-GVKARSILCCMRHQPNWSPKVVELCKKYQQ------QTVVAIDLAGDET--------IPG 190

  Fly   334 LSDLPSTANYF-----------FHAGETNWNGRTDWNMMDAILLNTKRIGHAFALPKHPQLWSTI 387
            .|.||.....:           .||||.   |..:.......:|.|:|:||.:...:...|::.:
Human   191 SSLLPGHVQAYQEAVKSGIHRTVHAGEV---GSAEVVKEAVDILKTERLGHGYHTLEDQALYNRL 252

  Fly   388 KKRNIAIEVNPISNQVLGFVWD---------LRNHPASFLIAENFPIVISSDDPGVWGAKGLSYD 443
            ::.|:..|:.|.|:.:.| .|.         |:|..|::.:..:.|::..|.         |..|
Human   253 RQENMHFEICPWSSYLTG-AWKPDTEHAVIRLKNDQANYSLNTDDPLIFKST---------LDTD 307

  Fly   444 FYYAFMALAPADADLRF----LKQLALNSIKYAVLTSDERRKI 482
            :..       ...|:.|    .|:|.:|:.|.:.|..||:|::
Human   308 YQM-------TKRDMGFTEEEFKRLNINAAKSSFLPEDEKREL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-DNP_524345.2 A_deaminase_N 4..100 CDD:285627
adm_rel 27..498 CDD:273620 77/368 (21%)
ADGF 80..490 CDD:238646 77/368 (21%)
ADANP_000013.2 metallo-dependent_hydrolases 9..347 CDD:320877 77/368 (21%)
Required for binding to DDP4. /evidence=ECO:0000269|PubMed:15016824 126..143 1/16 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.