DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f-cup and PIRL3

DIOPT Version :9

Sequence 1:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_563921.1 Gene:PIRL3 / 837855 AraportID:AT1G12970 Length:464 Species:Arabidopsis thaliana


Alignment Length:372 Identity:101/372 - (27%)
Similarity:156/372 - (41%) Gaps:68/372 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KRLYDINEADADSKAVNLEQLT----IKEE------DAWWNQVPLNNLDLSSNTLTHISPKIENL 178
            |:|.|:.|......|..:|.|:    :.||      ||....| :..:|||.:.|..:...:..:
plant   120 KQLRDLEEEIGRVYASAVESLSGGDEVNEEVLAVIKDAEDGGV-VERIDLSDHELKLLPDALGKI 183

  Fly   179 QSLTVLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVELNPD 243
            ..|..|.:..|.|..||..|..||||..|::|.|:|..||.::..|..||.||::.|:...|...
plant   184 VGLVSLNVSRNNLRFLPDTISGLEKLEELDLSSNRLVFLPDSIGLLLNLRILNVTGNKLTLLPES 248

  Fly   244 ISDLHMLEFLDGGHNNIQSLPGGIGF-LVRLTALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLT 307
            |:....|..||...||:.|||...|: |:.|..|.:..|.|:..|..:..||||:.:|...|::.
plant   249 IAQCRSLVELDASFNNLTSLPANFGYGLLNLERLSIQLNKIRFFPNSICEMRSLRYLDAHMNEIH 313

  Fly   308 SLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCSNLPHLKILDLRD 372
            .||..:|.|..|:.:.|                      |:||..:|                  
plant   314 GLPIAIGRLTNLEVMNL----------------------SSNFSDLI------------------ 338

  Fly   373 NKITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNPIKTIRRDILQCGTTRIL 437
                ||||.:..|.||..||:|||.|.|||.:...|..|..|.::.||::...::::......:.
plant   339 ----ELPDTISDLANLRELDLSNNQIRVLPDSFFRLEKLEKLNLDQNPLEYPPQEMVNQSAEAVR 399

  Fly   438 KTLHDR------------AVAKAKEEGGGVDDASTSAGISVTRLRGG 472
            :.:..|            .:...|::||.....|..:.|..:...||
plant   400 EFMRKRWEEMVEEEQLRSVIEAEKQQGGATGWLSWGSSIVTSLFSGG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380 5/15 (33%)
LRR_RI 155..>377 CDD:238064 61/222 (27%)
leucine-rich repeat 158..180 CDD:275380 4/21 (19%)
LRR_8 180..235 CDD:290566 22/54 (41%)
leucine-rich repeat 181..203 CDD:275380 8/21 (38%)
leucine-rich repeat 204..226 CDD:275380 8/21 (38%)
LRR_8 225..283 CDD:290566 20/58 (34%)
leucine-rich repeat 227..249 CDD:275380 7/21 (33%)
leucine-rich repeat 250..272 CDD:275380 10/22 (45%)
LRR_8 272..329 CDD:290566 17/56 (30%)
leucine-rich repeat 273..295 CDD:275380 6/21 (29%)
leucine-rich repeat 296..318 CDD:275380 7/21 (33%)
LRR_8 317..375 CDD:290566 6/57 (11%)
leucine-rich repeat 319..340 CDD:275380 2/20 (10%)
leucine-rich repeat 341..364 CDD:275380 4/22 (18%)
leucine-rich repeat 389..410 CDD:275380 10/20 (50%)
leucine-rich repeat 411..430 CDD:275380 4/18 (22%)
leucine-rich repeat 627..650 CDD:275380
leucine-rich repeat 651..669 CDD:275380
leucine-rich repeat 697..719 CDD:275380
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
PIRL3NP_563921.1 leucine-rich repeat 163..185 CDD:275380 4/21 (19%)
LRR <185..385 CDD:227223 77/243 (32%)
leucine-rich repeat 186..208 CDD:275380 8/21 (38%)
leucine-rich repeat 209..231 CDD:275380 8/21 (38%)
leucine-rich repeat 232..254 CDD:275380 7/21 (33%)
leucine-rich repeat 255..278 CDD:275380 10/22 (45%)
leucine-rich repeat 279..301 CDD:275380 6/21 (29%)
leucine-rich repeat 302..324 CDD:275380 7/21 (33%)
leucine-rich repeat 325..349 CDD:275380 11/67 (16%)
leucine-rich repeat 350..372 CDD:275380 11/21 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45752
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.