DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f-cup and PIRL8

DIOPT Version :9

Sequence 1:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_194335.2 Gene:PIRL8 / 828711 AraportID:AT4G26050 Length:383 Species:Arabidopsis thaliana


Alignment Length:393 Identity:106/393 - (26%)
Similarity:169/393 - (43%) Gaps:80/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TQELWKLARKSGTLNLSNKALARVPKRLYDINEADADSKAVNLEQLTIKEEDAWWNQVPLNNLDL 163
            |..:.|...|.|.:|...|.:.|     ..::..|..:.|      |.||.|...|   :..|||
plant    14 TTAMMKNYNKKGLINTPQKKMTR-----RSVSAIDGGAAA------TAKEGDRRQN---IKTLDL 64

  Fly   164 SSNTLTHISPKIENLQSLTVLTLHDNALVELPPE-IGKLEKLVRLNVSHNKLSQLPRAMYSLPEL 227
            |..:|..:|....||.|::.|.|.:|.:.::|.. :.::..|..|::..|:|..||.::..|.:|
plant    65 SGMSLASLSASSINLASISKLDLSNNNIQKIPESLVARMLNLWALDLQSNQLKTLPNSIGCLSKL 129

  Fly   228 RHLNISYNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGF-LVRLTALLLPYNHIKELPPDLV 291
            :.||:|.|....|...|.|...||.|:...|.:..||..||| |..||.|.:..|.:..||..:.
plant   130 KFLNVSGNYLQSLPKTIEDCRSLEELNANFNELTRLPDAIGFELTNLTKLSVNSNKLVLLPNSVS 194

  Fly   292 NMRSLQKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPK 356
            .:.||:.:|...|.|:|||||:                                           
plant   195 YLTSLRVLDARLNRLSSLPEDL------------------------------------------- 216

  Fly   357 AMCSNLPHLKILDLRDN--KITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGN 419
               .||.:|::|::..|  .:|.||..:.||.:|..||||.|.|:|||.:|..|..:..|.||||
plant   217 ---ENLVNLQVLNVSQNFQHLTTLPYSVGLLISLVELDVSYNGITVLPDSLGCLRRIQKLSVEGN 278

  Fly   420 PIKTIRRDILQCGTTRILKTLHDRAV-----AKAKEEGGGVD-----DASTSAGISVTRLRGGQM 474
            |:.:...::::.|...:.:.:.::..     ...|::..|:.     ..|:|.|.|..|      
plant   279 PLISPPFEVVEQGLEALKQYMSEKMTESYKKTPTKKKSWGIGKLVKYGLSSSPGRSTGR------ 337

  Fly   475 DDG 477
            :||
plant   338 EDG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380 5/28 (18%)
LRR_RI 155..>377 CDD:238064 59/225 (26%)
leucine-rich repeat 158..180 CDD:275380 8/21 (38%)
LRR_8 180..235 CDD:290566 16/55 (29%)
leucine-rich repeat 181..203 CDD:275380 4/22 (18%)
leucine-rich repeat 204..226 CDD:275380 7/21 (33%)
LRR_8 225..283 CDD:290566 22/58 (38%)
leucine-rich repeat 227..249 CDD:275380 8/21 (38%)
leucine-rich repeat 250..272 CDD:275380 10/22 (45%)
LRR_8 272..329 CDD:290566 16/56 (29%)
leucine-rich repeat 273..295 CDD:275380 6/21 (29%)
leucine-rich repeat 296..318 CDD:275380 9/21 (43%)
LRR_8 317..375 CDD:290566 5/59 (8%)
leucine-rich repeat 319..340 CDD:275380 0/20 (0%)
leucine-rich repeat 341..364 CDD:275380 2/22 (9%)
leucine-rich repeat 389..410 CDD:275380 11/20 (55%)
leucine-rich repeat 411..430 CDD:275380 6/18 (33%)
leucine-rich repeat 627..650 CDD:275380
leucine-rich repeat 651..669 CDD:275380
leucine-rich repeat 697..719 CDD:275380
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
PIRL8NP_194335.2 PRK15370 <81..>308 CDD:185268 75/272 (28%)
leucine-rich repeat 84..105 CDD:275380 4/20 (20%)
leucine-rich repeat 106..128 CDD:275380 7/21 (33%)
leucine-rich repeat 129..151 CDD:275380 8/21 (38%)
leucine-rich repeat 152..175 CDD:275380 10/22 (45%)
leucine-rich repeat 176..198 CDD:275380 6/21 (29%)
leucine-rich repeat 199..221 CDD:275380 11/67 (16%)
leucine-rich repeat 222..246 CDD:275380 8/23 (35%)
leucine-rich repeat 247..269 CDD:275380 12/21 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45752
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.