DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f-cup and CG10307

DIOPT Version :9

Sequence 1:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_001286690.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster


Alignment Length:358 Identity:92/358 - (25%)
Similarity:145/358 - (40%) Gaps:70/358 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 EDAWWNQVPLNNLDLSSNTLTHISPKIENLQSLTVLTLHDNALVELPPEIGKLEKLVRLNVSHNK 213
            |||.:.:.  .:|:||...::.:...||..::|..|.|:.|.|.::|..||.|.:|..|.:.:||
  Fly    18 EDAIYKKA--FSLNLSHYQISDVPGIIEKCETLMKLFLNQNKLTKIPSSIGSLMRLQVLTLDYNK 80

  Fly   214 LSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLL 278
            |.:.|..:..|..|:.||||.                       |||.|||..:|:|.:|.....
  Fly    81 LDEFPLCICRLVRLKFLNISC-----------------------NNISSLPPELGYLTQLETFWC 122

  Fly   279 PYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNE 343
            ....:.|||.::.|...|:.:.:..|.|..||:.:|.|..|..|..:..::.|:|          
  Fly   123 NNTGLLELPNEIRNCEHLETLGVRGNPLKKLPDAIGALSSLRWLTAEGCELSEVP---------- 177

  Fly   344 LHASNNFIKIIPKAMCSNLPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLPV--TLS 406
                      :..|:..||.|   |:|:.|::..||..|..::.|....::.|.|..:|.  .|.
  Fly   178 ----------LTMALLGNLVH---LNLKGNRLRRLPRMLMAMQKLRFAFLNENCIDEMPTRSQLE 229

  Fly   407 SLAHLISLQVEGNPIKTIRRDI-------------LQCGTTRILKTLHDRAVAKAKEE------G 452
            .|..|..|.:..||| ::.||:             |......|...|..||...|:|:      |
  Fly   230 ELRTLHMLNLSKNPI-SLHRDLQLMALRQTNLYVELPSDPANICDGLASRASLNAQEQQEDQARG 293

  Fly   453 GGVDDASTSAGISVTRLRGGQMDDGDIPGNFPD 485
            .|.|..|:....||........|:..:..|..|
  Fly   294 AGQDLDSSDWANSVRTSELDTTDESALENNIED 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380
LRR_RI 155..>377 CDD:238064 57/221 (26%)
leucine-rich repeat 158..180 CDD:275380 5/21 (24%)
LRR_8 180..235 CDD:290566 21/54 (39%)
leucine-rich repeat 181..203 CDD:275380 9/21 (43%)
leucine-rich repeat 204..226 CDD:275380 7/21 (33%)
LRR_8 225..283 CDD:290566 14/57 (25%)
leucine-rich repeat 227..249 CDD:275380 5/21 (24%)
leucine-rich repeat 250..272 CDD:275380 8/21 (38%)
LRR_8 272..329 CDD:290566 14/56 (25%)
leucine-rich repeat 273..295 CDD:275380 5/21 (24%)
leucine-rich repeat 296..318 CDD:275380 7/21 (33%)
LRR_8 317..375 CDD:290566 11/57 (19%)
leucine-rich repeat 319..340 CDD:275380 4/20 (20%)
leucine-rich repeat 341..364 CDD:275380 3/22 (14%)
leucine-rich repeat 389..410 CDD:275380 5/22 (23%)
leucine-rich repeat 411..430 CDD:275380 7/31 (23%)
leucine-rich repeat 627..650 CDD:275380
leucine-rich repeat 651..669 CDD:275380
leucine-rich repeat 697..719 CDD:275380
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
CG10307NP_001286690.1 leucine-rich repeat 27..44 CDD:275380 4/16 (25%)
LRR_8 47..104 CDD:290566 22/79 (28%)
leucine-rich repeat 48..70 CDD:275380 9/21 (43%)
LRR 69..>244 CDD:227223 55/220 (25%)
leucine-rich repeat 71..93 CDD:275380 7/21 (33%)
leucine-rich repeat 94..116 CDD:275380 13/44 (30%)
leucine-rich repeat 117..139 CDD:275380 5/21 (24%)
leucine-rich repeat 140..162 CDD:275380 7/21 (33%)
leucine-rich repeat 163..185 CDD:275380 5/41 (12%)
leucine-rich repeat 186..208 CDD:275380 8/24 (33%)
leucine-rich repeat 209..233 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45752
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.