DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f-cup and CG11099

DIOPT Version :9

Sequence 1:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster


Alignment Length:260 Identity:65/260 - (25%)
Similarity:122/260 - (46%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 ELPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHMLEFLDGGH 257
            ::|.::...|.|..:.:..|.:|.:|:.:.::..|:.::::.|...||..||..|..|||||..:
  Fly    15 DVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYMLENLEFLDVSN 79

  Fly   258 NNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDCL 322
            |.::.||..:|.|:.|..|.:..|.:.|||.:|..:|:|:.:::..|....||..:.     :|:
  Fly    80 NELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRLPVQLS-----ECV 139

  Fly   323 YLQHNDILELPEFEGNEALNELHASNNFIKI-IPKAMCSNLPHLKILDLRDNKITELPDELCLLR 386
                             .||||:.|:|...: ||:.: ||||.|:.|......:..||  ..|.:
  Fly   140 -----------------RLNELNVSDNEALVHIPERI-SNLPMLQSLAADRCALVYLP--AALSK 184

  Fly   387 NLNRLDVSNNT-ISVLPVTLSSL-AHLISLQVEGNPIKTIRRDILQC----GTTRILKTLHDRAV 445
            .:|.:.:.:|| |:.:|:..... .:....:....|:...|:.:...    .:||:|..:..|.|
  Fly   185 FMNHVRIFHNTAINYIPMVYERFYQNFYDNRQRNTPVAVHRKGLFWVRELETSTRLLLPVGTRTV 249

  Fly   446  445
              Fly   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380
LRR_RI 155..>377 CDD:238064 50/184 (27%)
leucine-rich repeat 158..180 CDD:275380
LRR_8 180..235 CDD:290566 7/41 (17%)
leucine-rich repeat 181..203 CDD:275380 1/9 (11%)
leucine-rich repeat 204..226 CDD:275380 4/21 (19%)
LRR_8 225..283 CDD:290566 20/57 (35%)
leucine-rich repeat 227..249 CDD:275380 7/21 (33%)
leucine-rich repeat 250..272 CDD:275380 10/21 (48%)
LRR_8 272..329 CDD:290566 13/56 (23%)
leucine-rich repeat 273..295 CDD:275380 7/21 (33%)
leucine-rich repeat 296..318 CDD:275380 4/21 (19%)
LRR_8 317..375 CDD:290566 15/58 (26%)
leucine-rich repeat 319..340 CDD:275380 1/20 (5%)
leucine-rich repeat 341..364 CDD:275380 11/23 (48%)
leucine-rich repeat 389..410 CDD:275380 5/22 (23%)
leucine-rich repeat 411..430 CDD:275380 2/18 (11%)
leucine-rich repeat 627..650 CDD:275380
leucine-rich repeat 651..669 CDD:275380
leucine-rich repeat 697..719 CDD:275380
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 1/9 (11%)
LRR_8 26..82 CDD:290566 17/55 (31%)
leucine-rich repeat 26..48 CDD:275380 4/21 (19%)
LRR <43..>194 CDD:227223 48/175 (27%)
LRR_4 47..87 CDD:289563 14/39 (36%)
leucine-rich repeat 49..71 CDD:275380 7/21 (33%)
leucine-rich repeat 72..95 CDD:275380 10/22 (45%)
leucine-rich repeat 96..117 CDD:275380 6/20 (30%)
leucine-rich repeat 118..140 CDD:275380 5/43 (12%)
leucine-rich repeat 141..164 CDD:275380 11/23 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.