DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f-cup and Lap1

DIOPT Version :9

Sequence 1:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster


Alignment Length:873 Identity:194/873 - (22%)
Similarity:308/873 - (35%) Gaps:261/873 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ELWKLARKSGTLNLSNKALARVPKRLY----------DINEADADSKAV-NLEQLTIKEEDAWWN 154
            |:|:..|....|.||...|..:|.:|:          :.|..::..:|: :|.||  :..|...|
  Fly    34 EVWQHERTLEELYLSTTRLQALPPQLFYCQGLRVLHVNSNNLESIPQAIGSLRQL--QHLDLNRN 96

  Fly   155 ---QVP--------LNNLDLSSNTLTHISPKIENLQSLTVLTLHDNALVELPPEIGKLEKLVRLN 208
               .||        |.:||||.|:|..:...|.:|.||..|.|::..|..||...|:|..|..|.
  Fly    97 LIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQELLLNETYLEFLPANFGRLVNLRILE 161

  Fly   209 VSHNKLSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRL 273
            :..|.|..||::|..|..|:.|:|..|||.||...:.:|..|..|....|.|:.:...||.|..|
  Fly   162 LRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDL 226

  Fly   274 TALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPE-FEG 337
            .......|.:..||.:|.|.|:::.:.:..|.|.:.|..:|:|:.|.....:.|.:.|||: ...
  Fly   227 QHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISY 291

  Fly   338 NEALNELHASNNFIKIIPKAMCSNLPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLP 402
            .|.|.||..|:|.:..:|..: ..|..|:.|...||::.:||||||..:.|:.|.|:||.:|.||
  Fly   292 LEQLEELVLSHNKLIRLPSTI-GMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALP 355

  Fly   403 VTLSSLAHLISLQVEGNPIKTIRRDILQCG--TTRILKTLHDRAVAKAKEEGGGVDDASTSAGIS 465
            ..:.:|:.:..|.|..|.|..:...:|...  |:..|.....:.:...:     ..||||...::
  Fly   356 QNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSDNQSQPLVPLQ-----YLDASTKTQLT 415

  Fly   466 VTRLRGGQMDDGDIPG-NFPDSFHHQQQQNGFQCPCSYPCQQQ---QMQQQFCVYE--------- 517
            ...|          |. .|..:....|||...|....|..|||   ...::.|..|         
  Fly   416 CFML----------PQVTFKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRICFAEEATILSNAK 470

  Fly   518 -------------------------------------PLRNCQEYDRQ----------------- 528
                                                 .||...:|.||                 
  Fly   471 AQPAPNYPSFVAAPPTPTPDQMAGSVRLMRSPTPYPKELRQMSKYVRQAQAATSSANASEVREAR 535

  Fly   529 --TQGRIYEPENYQQQH--QNGSLRSLF-----------VQQQQQRMEYPYP----------GYF 568
              |.|:|:...|...|.  ...:..:::           |.||.|:|.:|.|          .|.
  Fly   536 VVTNGQIHCDSNNANQDVVDQATTSAIYGIAPETTHIYGVYQQPQQMAHPVPTQEYYGLPLVNYE 600

  Fly   569 MYQQQ-------------------------QQQQFSYEQDPSSRSAVHPRWV------------- 595
            .:.||                         |||....:..|:.|....|..:             
  Fly   601 AHYQQLYVEANTPLPTTHLNGDQDYELQPLQQQPMQQQALPTPRLEPPPYHIARVYTKKTPEDLN 665

  Fly   596 -YKLRHTRTLAVNLEELTSVPDQVFQIARDEGVHVVDFARNQLSTLPNGLQHMKDLVTELVLSNN 659
             |:....|.....|:|.|     ::|.|.:        :.:...|...|.|.:::.|.:|...||
  Fly   666 LYESMRQRKQQQQLQEQT-----IYQDALN--------SNSNFKTTAIGAQDVEESVDQLDYQNN 717

  Fly   660 VIGYVPQFISQFTRISFLNLSNNL----------LNDLPTEFGVLNTLRELNIAN---------- 704
            :                   ||||          |:|..::.. ||:....|.:.          
  Fly   718 I-------------------SNNLEPNPEEEDQELDDTMSQHS-LNSTATNNTSKASHKKSTWIF 762

  Fly   705 --NRFPCIPNCVYELQGLEILIASENHI-----KMLNVSGL--------QNMRRLSTL------- 747
              ::.|.:.         ::.:..||.|     ::||..|:        .|..||..|       
  Fly   763 GVHKNPTVK---------QVTLKWENSIGFDIAELLNQVGIFVSSITPNTNAARLLNLNDKLLEI 818

  Fly   748 ---DLRNNDIETVPPILGNLTNITHLEL 772
               ||.|.::.....:|.|...:.::.|
  Fly   819 DGYDLTNANLSDAKRVLLNCGTVMNIML 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380 8/39 (21%)
LRR_RI 155..>377 CDD:238064 73/230 (32%)
leucine-rich repeat 158..180 CDD:275380 9/21 (43%)
LRR_8 180..235 CDD:290566 20/54 (37%)
leucine-rich repeat 181..203 CDD:275380 8/21 (38%)
leucine-rich repeat 204..226 CDD:275380 8/21 (38%)
LRR_8 225..283 CDD:290566 18/57 (32%)
leucine-rich repeat 227..249 CDD:275380 9/21 (43%)
leucine-rich repeat 250..272 CDD:275380 7/21 (33%)
LRR_8 272..329 CDD:290566 14/56 (25%)
leucine-rich repeat 273..295 CDD:275380 6/21 (29%)
leucine-rich repeat 296..318 CDD:275380 5/21 (24%)
LRR_8 317..375 CDD:290566 17/58 (29%)
leucine-rich repeat 319..340 CDD:275380 5/21 (24%)
leucine-rich repeat 341..364 CDD:275380 7/22 (32%)
leucine-rich repeat 389..410 CDD:275380 8/20 (40%)
leucine-rich repeat 411..430 CDD:275380 4/18 (22%)
leucine-rich repeat 627..650 CDD:275380 3/22 (14%)
leucine-rich repeat 651..669 CDD:275380 4/17 (24%)
leucine-rich repeat 697..719 CDD:275380 2/33 (6%)
LRR_8 719..777 CDD:290566 16/77 (21%)
leucine-rich repeat 720..743 CDD:275380 7/35 (20%)
leucine-rich repeat 744..766 CDD:275380 7/31 (23%)
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 52/167 (31%)
leucine-rich repeat 21..41 CDD:275380 2/6 (33%)
LRR_8 40..98 CDD:290566 14/59 (24%)
leucine-rich repeat 42..64 CDD:275380 6/21 (29%)
leucine-rich repeat 65..87 CDD:275380 3/21 (14%)
LRR_8 86..140 CDD:290566 18/55 (33%)
leucine-rich repeat 88..110 CDD:275380 5/23 (22%)
leucine-rich repeat 111..133 CDD:275380 9/21 (43%)
leucine-rich repeat 134..156 CDD:275380 8/21 (38%)
LRR_8 156..213 CDD:290566 20/56 (36%)
leucine-rich repeat 157..179 CDD:275380 8/21 (38%)
leucine-rich repeat 180..202 CDD:275380 9/21 (43%)
leucine-rich repeat 203..225 CDD:275380 7/21 (33%)
leucine-rich repeat 226..248 CDD:275380 6/21 (29%)
leucine-rich repeat 272..294 CDD:275380 5/21 (24%)
LRR_8 279..328 CDD:290566 16/49 (33%)
leucine-rich repeat 295..317 CDD:275380 7/22 (32%)
leucine-rich repeat 318..340 CDD:275380 10/21 (48%)
LRR_8 340..396 CDD:290566 16/55 (29%)
leucine-rich repeat 364..386 CDD:275380 5/21 (24%)
PDZ_signaling 770..846 CDD:238492 15/84 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47116
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.