DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f-cup and ics

DIOPT Version :9

Sequence 1:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster
Sequence 2:NP_001285902.1 Gene:ics / 34774 FlyBaseID:FBgn0028546 Length:283 Species:Drosophila melanogaster


Alignment Length:292 Identity:85/292 - (29%)
Similarity:135/292 - (46%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LDLSSNTLTHIS--PKIENLQSLTVLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYS 223
            |||:...|:...  |.:.|:.::|.|||..|.:..:.|.|..|..|..||:|:|:|::||.::.|
  Fly    30 LDLADKGLSSFEELPGLFNMSNITRLTLSHNKISVISPGIANLLNLEILNLSNNQLTELPVSLSS 94

  Fly   224 LPELRHLNISYNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLLPYNHIKE--L 286
            :|:||.||:|.|..:                       :||.|.|....|..|.|.||::.|  |
  Fly    95 MPKLRILNVSINRLI-----------------------NLPRGFGAFPVLEVLDLSYNNLNEQVL 136

  Fly   287 PPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGN-EALNELHASNNF 350
            |.:...|.:|:.:.|..||...:|:::|.|:.|..|.|:.||:||||...|: ..|.|||..||.
  Fly   137 PGNFFGMETLRALYLGDNDFEYIPKEVGQLKNLQILGLRDNDLLELPREVGDLVRLRELHIQNNR 201

  Fly   351 IKIIPKAMCSNLPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLPVT---LSSLAHLI 412
            ::::|       |.:..|||..||.....:|             |..::  |:.   |..::|:|
  Fly   202 LQVLP-------PEIAQLDLLSNKSVMKMEE-------------NPWVN--PIAEQYLLGISHVI 244

  Fly   413 SLQVEGNPIKTIRRDILQCGTTRILKTLHDRA 444
                          |.|:..|.:|:...|.:|
  Fly   245 --------------DYLKTETYKIIYNRHLQA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380
LRR_RI 155..>377 CDD:238064 73/220 (33%)
leucine-rich repeat 158..180 CDD:275380 6/20 (30%)
LRR_8 180..235 CDD:290566 23/54 (43%)
leucine-rich repeat 181..203 CDD:275380 8/21 (38%)
leucine-rich repeat 204..226 CDD:275380 9/21 (43%)
LRR_8 225..283 CDD:290566 16/57 (28%)
leucine-rich repeat 227..249 CDD:275380 6/21 (29%)
leucine-rich repeat 250..272 CDD:275380 4/21 (19%)
LRR_8 272..329 CDD:290566 20/58 (34%)
leucine-rich repeat 273..295 CDD:275380 9/23 (39%)
leucine-rich repeat 296..318 CDD:275380 7/21 (33%)
LRR_8 317..375 CDD:290566 22/58 (38%)
leucine-rich repeat 319..340 CDD:275380 10/21 (48%)
leucine-rich repeat 341..364 CDD:275380 7/22 (32%)
leucine-rich repeat 389..410 CDD:275380 3/23 (13%)
leucine-rich repeat 411..430 CDD:275380 2/18 (11%)
leucine-rich repeat 627..650 CDD:275380
leucine-rich repeat 651..669 CDD:275380
leucine-rich repeat 697..719 CDD:275380
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
icsNP_001285902.1 leucine-rich repeat 29..51 CDD:275380 6/20 (30%)
leucine-rich repeat 52..84 CDD:275380 12/31 (39%)
LRR_8 96..156 CDD:290566 23/82 (28%)
leucine-rich repeat 98..120 CDD:275380 10/44 (23%)
LRR 119..>222 CDD:227223 39/109 (36%)
leucine-rich repeat 121..145 CDD:275380 9/23 (39%)
leucine-rich repeat 146..168 CDD:275380 7/21 (33%)
leucine-rich repeat 169..191 CDD:275380 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.