Sequence 1: | NP_001262544.1 | Gene: | f-cup / 41677 | FlyBaseID: | FBgn0028487 | Length: | 802 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001029311.1 | Gene: | Lrrc8e / 304203 | RGDID: | 1311979 | Length: | 795 | Species: | Rattus norvegicus |
Alignment Length: | 255 | Identity: | 75/255 - (29%) |
---|---|---|---|
Similarity: | 117/255 - (45%) | Gaps: | 41/255 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 STHEDDQVL--TQELWKLA--RKSGTLNLSNKALARVPKRLYDINEADADSKAVNLEQLTIKEED 150
Fly 151 AWWNQVPLNNLDLSSNTLTHISP--KIENLQSLTVLTLHDNALVELPPEIGKLEKLVRLNVSHNK 213
Fly 214 LSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLL 278
Fly 279 PYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDIL-ELPEFEG 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
f-cup | NP_001262544.1 | leucine-rich repeat | 111..140 | CDD:275380 | 5/28 (18%) |
LRR_RI | 155..>377 | CDD:238064 | 61/186 (33%) | ||
leucine-rich repeat | 158..180 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 180..235 | CDD:290566 | 20/54 (37%) | ||
leucine-rich repeat | 181..203 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 204..226 | CDD:275380 | 9/21 (43%) | ||
LRR_8 | 225..283 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 227..249 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 250..272 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 272..329 | CDD:290566 | 19/56 (34%) | ||
leucine-rich repeat | 273..295 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 296..318 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 317..375 | CDD:290566 | 7/22 (32%) | ||
leucine-rich repeat | 319..340 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 341..364 | CDD:275380 | |||
leucine-rich repeat | 389..410 | CDD:275380 | |||
leucine-rich repeat | 411..430 | CDD:275380 | |||
leucine-rich repeat | 627..650 | CDD:275380 | |||
leucine-rich repeat | 651..669 | CDD:275380 | |||
leucine-rich repeat | 697..719 | CDD:275380 | |||
LRR_8 | 719..777 | CDD:290566 | |||
leucine-rich repeat | 720..743 | CDD:275380 | |||
leucine-rich repeat | 744..766 | CDD:275380 | |||
Lrrc8e | NP_001029311.1 | Pannexin_like | 1..330 | CDD:289311 | |
leucine-rich repeat | 508..532 | CDD:275380 | |||
LRR_RI | 526..790 | CDD:238064 | 75/255 (29%) | ||
LRR 1 | 535..556 | ||||
leucine-rich repeat | 536..558 | CDD:275380 | |||
LRR 2 | 558..578 | 4/14 (29%) | |||
leucine-rich repeat | 559..582 | CDD:275380 | 7/18 (39%) | ||
LRR 3 | 582..603 | 6/23 (26%) | |||
LRR_8 | 583..641 | CDD:290566 | 17/86 (20%) | ||
leucine-rich repeat | 583..605 | CDD:275380 | 6/50 (12%) | ||
LRR 4 | 605..626 | 7/20 (35%) | |||
leucine-rich repeat | 606..630 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 629..687 | CDD:290566 | 21/57 (37%) | ||
LRR 5 | 630..651 | 5/20 (25%) | |||
leucine-rich repeat | 631..653 | CDD:275380 | 7/21 (33%) | ||
LRR 6 | 653..674 | 9/20 (45%) | |||
leucine-rich repeat | 654..676 | CDD:275380 | 9/21 (43%) | ||
LRR_8 | 676..733 | CDD:290566 | 21/56 (38%) | ||
LRR 7 | 676..697 | 7/20 (35%) | |||
leucine-rich repeat | 677..699 | CDD:275380 | 8/21 (38%) | ||
LRR 8 | 699..720 | 6/20 (30%) | |||
leucine-rich repeat | 700..722 | CDD:275380 | 7/21 (33%) | ||
LRR 9 | 722..743 | 8/20 (40%) | |||
leucine-rich repeat | 723..745 | CDD:275380 | 8/21 (38%) | ||
LRR 10 | 745..766 | 8/25 (32%) | |||
leucine-rich repeat | 746..766 | CDD:275380 | 8/24 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |