DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14367 and cfap-36

DIOPT Version :9

Sequence 1:NP_650305.1 Gene:CG14367 / 41676 FlyBaseID:FBgn0038170 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_503147.1 Gene:cfap-36 / 190931 WormBaseID:WBGene00022435 Length:685 Species:Caenorhabditis elegans


Alignment Length:256 Identity:72/256 - (28%)
Similarity:126/256 - (49%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLHGPIWNAPLQTFIEQKSLVFDPNQQLDENNPDI-LQIHEEYKNLVDYMLGSFMEEMQISPEQF 78
            |:...||:.|:.:|||.:|:||| .||::   .|: :.||:||..|:|.::..|.|::..:|.:.
 Worm    33 FITSSIWSIPIASFIESQSVVFD-RQQME---TDVYIMIHKEYSQLIDTLIECFCEDVGTTPTEL 93

  Fly    79 EMACLEGRQQGQGENPFHFHQVLFQQIWAANDLKIFIRMMTQRNVELQLQALDLIE-KNQLAPG- 141
            ..|.....|:...:.    ::|..:.:.||.:..:|:.||.::|:|||||||.:|| ...|.|. 
 Worm    94 VAAIQLFNQKDVSQQ----YKVALEPLLAAQNFNVFVPMMMRKNIELQLQALQMIEFMCGLIPSV 154

  Fly   142 -GVEEGDDRSADASSDPGDTASEVEQMIAKTVSDELESPEAALTPEQEPNLELVNDKFQRLNLFF 205
             .:|:|:.........|.:|...|...:.:...||.:|.:..   .:|..:...|.:.||..|  
 Worm   155 LQLEDGETLRNMKKLSPEETERYVLISVLRHSKDEYDSMQKG---SEELEMMAQNSRIQREAL-- 214

  Fly   206 EQEDRVDPSDVVSRQEYLRQQR-DKIVEIKKQTRAKQLQETMSRGTPHAPEGARPSSALVA 265
            |||        :.::|.|.||. |:....:.|.:.:....|.:.|. :||  .|..:|::|
 Worm   215 EQE--------IRKEEILLQQALDEGARAQNQNQNQGTSSTQTDGV-NAP--LRSVAAMMA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14367NP_650305.1 ARL2_Bind_BART 9..125 CDD:288392 32/110 (29%)
cfap-36NP_503147.1 ARL2_Bind_BART 31..136 CDD:314433 32/110 (29%)
Herpes_ICP4_C 289..>546 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162615
Domainoid 1 1.000 63 1.000 Domainoid score I6813
eggNOG 1 0.900 - - E1_KOG4511
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006980
OrthoInspector 1 1.000 - - oto19258
orthoMCL 1 0.900 - - OOG6_105908
Panther 1 1.100 - - LDO PTHR21532
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4195
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.