DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flfl and ppp4r3b

DIOPT Version :10

Sequence 1:NP_731849.2 Gene:flfl / 41675 FlyBaseID:FBgn0024555 Length:980 Species:Drosophila melanogaster
Sequence 2:NP_001005004.1 Gene:ppp4r3b / 448490 XenbaseID:XB-GENE-1004661 Length:820 Species:Xenopus tropicalis


Alignment Length:84 Identity:19/84 - (22%)
Similarity:31/84 - (36%) Gaps:23/84 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 MTLVAILLAVIMSFFYSWKM---------SLQVLMFC-----PLLYLAGYCNDNFV--------- 758
            |.:|.||||.:..:...|:.         ||.:|:.|     |...|..:.....:         
 Frog     1 MVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGS 65

  Fly   759 DQAVEEDSIAFEKSNRAAI 777
            :|..|:..|..|:|...|:
 Frog    66 EQGWEDPPIGAEQSFHLAL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flflNP_731849.2 PH-like 8..>66 CDD:473070
PP4R3 169..361 CDD:461435
ppp4r3bNP_001005004.1 PH-like 7..>65 CDD:473070 10/57 (18%)
PP4R3 168..359 CDD:461435
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 687..711
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 750..820
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.