DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flfl and LOC103911969

DIOPT Version :9

Sequence 1:NP_731849.2 Gene:flfl / 41675 FlyBaseID:FBgn0024555 Length:980 Species:Drosophila melanogaster
Sequence 2:XP_009305287.1 Gene:LOC103911969 / 103911969 -ID:- Length:142 Species:Danio rerio


Alignment Length:166 Identity:50/166 - (30%)
Similarity:80/166 - (48%) Gaps:48/166 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 MNDKKTKSASIDILTAIVEFSPLVVRNYTLNQANRPEVERMLLNIAIEQMLNDSEPELGIAVQLM 440
            |:|.:.|:|:.||.:.:|||||.:||.:.:.:..:.:.:.:|:|:.|:||:.||:||||.|||||
Zfish     3 MDDVQVKAAATDIFSYLVEFSPSMVREFVMQEPQQADDDVLLINVVIKQMICDSDPELGGAVQLM 67

  Fly   441 GIVKILLEPENMLTEKGDFLNFFYKYSVQTLVAPVILNTIGDRPQNEDYQTAQLLGIVLDILSFC 505
            |:::.|::|||||.                             |.|.. .|..||..::|     
Zfish    68 GLLRTLIDPENMLA-----------------------------PSNVS-NTHTLLRTLID----- 97

  Fly   506 VEHHSYHIKNFLLQKDLLKRILVLMKSTHTFLVLGA 541
                         .:::|....|....|||..:|||
Zfish    98 -------------PRNMLAHSNVRNTQTHTHTLLGA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flflNP_731849.2 PH-like 8..>66 CDD:302622
SMK-1 169..361 CDD:282636
LOC103911969XP_009305287.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D388216at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.