DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and BRSK1

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_115806.1 Gene:BRSK1 / 84446 HGNCID:18994 Length:778 Species:Homo sapiens


Alignment Length:283 Identity:104/283 - (36%)
Similarity:161/283 - (56%) Gaps:17/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQLKHRHV 233
            ||.|.:...||:|..|.||..::.....::|:||:.:.||..  :....|.||||:||.::|.||
Human    31 VGPYRLEKTLGKGQTGLVKLGVHCITGQKVAIKIVNREKLSE--SVLMKVEREIAILKLIEHPHV 93

  Fly   234 VELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDK-RMPLFQAHGYFKQLVDGLEYLHSCRVIH 297
            ::|.||.  |.|:.:|||:|:..||  |:.||...| |:...:|..:|:|:|..|::.||..:.|
Human    94 LKLHDVY--ENKKYLYLVLEHVSGG--ELFDYLVKKGRLTPKEARKFFRQIVSALDFCHSYSICH 154

  Fly   298 KDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGFKVDIW 362
            :|:||.||||.....::|:|||:|   .|...|....|..|||.:..||:..| |.:.|.:.|:|
Human   155 RDLKPENLLLDEKNNIRIADFGMA---SLQVGDSLLETSCGSPHYACPEVIKG-EKYDGRRADMW 215

  Fly   363 SSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSKRLSLQ 427
            |.||.|:.|..|..||:.||:.:|||.:.||.:..|.::   ..|..:|:.||::.:|.|||||:
Human   216 SCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFI---PPDCQSLLRGMIEVEPEKRLSLE 277

  Fly   428 EIRHDTWFRSAPVKTGP---PIP 447
            :|:...|:.....:..|   |.|
Human   278 QIQKHPWYLGGKHEPDPCLEPAP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 98/263 (37%)
STKc_LKB1 178..435 CDD:271021 97/257 (38%)
BRSK1NP_115806.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
STKc_BRSK1_2 32..285 CDD:270983 99/265 (37%)
UBA_BRSK 314..367 CDD:270525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 719..778
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.