DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and CIPK17

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_175260.1 Gene:CIPK17 / 841246 AraportID:AT1G48260 Length:432 Species:Arabidopsis thaliana


Alignment Length:396 Identity:115/396 - (29%)
Similarity:180/396 - (45%) Gaps:48/396 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQLKHRHV 233
            ||||.:|..||||:..|||.|:::......|:||:.|..:.|: |....:.|||..||.|||.::
plant     8 VGKYELGRTLGEGNSAKVKFAIDTLTGESFAIKIIEKSCITRL-NVSFQIKREIRTLKVLKHPNI 71

  Fly   234 VELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDK-RMPLFQAHGYFKQLVDGLEYLHSCRVIH 297
            |.|.:||  ..|.|:|:|:|...||  ::.|....| ::...|....|:||:||:.|.|:..|.|
plant    72 VRLHEVL--ASKTKIYMVLECVTGG--DLFDRIVSKGKLSETQGRKMFQQLIDGVSYCHNKGVFH 132

  Fly   298 KDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGFKVDIW 362
            :|:|..|:||.....:||:|||::.....:..|....|..|||.:..||:. .:|.:.|...|||
plant   133 RDLKLENVLLDAKGHIKITDFGLSALSQHYREDGLLHTTCGSPNYVAPEVL-ANEGYDGAASDIW 196

  Fly   363 SSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSKRLSLQ 427
            |.||.||.:.||..||:..|:..:...|.:|....|.|:   ......:|..||..:|..|:::.
plant   197 SCGVILYVILTGCLPFDDANLAVICRKIFKGDPPIPRWI---SLGAKTMIKRMLDPNPVTRVTIA 258

  Fly   428 EIRHDTWFRSAPVKTGPPIPIPPLKGDKYRNSTVIPYLEAYHYGTQEEDVYFTEHDV------NQ 486
            .|:...||:                    .:.|...|       ..::|||..:.||      .:
plant   259 GIKAHDWFK--------------------HDYTPSNY-------DDDDDVYLIQEDVFMMKEYEE 296

  Fly   487 ELARQAAAAASEIRAKQSAAALAACHTYEPPSTSAAA---ASNSLGNGSRE--EAPVKKKGSALK 546
            |.:..:....:..:....::.|.....:|....|...   .||||.....|  |....:.|..|:
plant   297 EKSPDSPTIINAFQLIGMSSFLDLSGFFETEKLSERQIRFTSNSLAKDLLENIETIFTEMGFCLQ 361

  Fly   547 RRAKKL 552
            ::..||
plant   362 KKHAKL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 89/263 (34%)
STKc_LKB1 178..435 CDD:271021 87/257 (34%)
CIPK17NP_175260.1 PKc_like 10..265 CDD:304357 90/263 (34%)
S_TKc 11..266 CDD:214567 89/263 (34%)
CIPK_C 307..418 CDD:213380 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.